PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G038200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 321aa    MW: 35482.8 Da    PI: 7.5423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G038200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W +eEdell d++k+ G g+W++ ++  g+ R++k+c++rw +yl
  Aqcoe7G038200.1.p 14 KGPWAPEEDELLTDYIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 61
                       79******************************99************97 PP

2Myb_DNA-binding543.9e-1767112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++T+eE++ +++++  lG++ W++Ia+ ++ gRt++++k++w+++l
  Aqcoe7G038200.1.p  67 RGPFTAEEEKTIIQLHGILGNR-WASIASQLP-GRTDNEIKNFWNTHL 112
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129414.954961IPR017930Myb domain
SuperFamilySSF466898.99E-3011108IPR009057Homeodomain-like
SMARTSM007174.3E-121363IPR001005SANT/Myb domain
PfamPF002493.7E-141461IPR001005SANT/Myb domain
CDDcd001671.77E-91661No hitNo description
PROSITE profilePS5129426.18162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2765117IPR009057Homeodomain-like
SMARTSM007175.9E-1766114IPR001005SANT/Myb domain
PfamPF002496.7E-1667112IPR001005SANT/Myb domain
CDDcd001672.56E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRAPCCDKL GLKKGPWAPE EDELLTDYIK KNGHGSWRSL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TAEEEKTIIQ LHGILGNRWA SIASQLPGRT DNEIKNFWNT HLKKRLVCMG  120
LDPHTHTPSS PLGHNAASSA SPSTRHMAQW ESARLEAEAR LSKESVQFGS QSNLLSKKAD  180
CDHFLRIWHS EVGESFRRLT TPGTTACQSS NSEASSSIKC EVDSGTTTEV KQANTGSLST  240
VSDQHEETKG KSFKTERDRD HVVAGSDSSC CNDLHDSADM SLQLLLDFPG GDEMNFFQAH  300
IGNYSMFPSL LMERSFISSP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273106.11e-151PREDICTED: myb-related protein 308-like
RefseqXP_010273105.11e-151PREDICTED: myb-related protein 308-like
RefseqXP_010273103.11e-151PREDICTED: myb-related protein 308-like
RefseqXP_010273102.11e-151PREDICTED: myb-related protein 308-like
TrEMBLA0A061E1591e-145A0A061E159_THECC; Myb domain protein 17 isoform 1
STRINGVIT_15s0046g03190.t011e-135(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-122myb domain protein 17